Anti CNN2 pAb (ATL-HPA049095)

Atlas Antibodies

SKU:
ATL-HPA049095-25
  • Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calponin 2
Gene Name: CNN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004665: 67%, ENSRNOG00000020457: 37%
Entrez Gene ID: 1265
Uniprot ID: Q99439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Gene Sequence PKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Gene ID - Mouse ENSMUSG00000004665
Gene ID - Rat ENSRNOG00000020457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNN2 pAb (ATL-HPA049095)
Datasheet Anti CNN2 pAb (ATL-HPA049095) Datasheet (External Link)
Vendor Page Anti CNN2 pAb (ATL-HPA049095) at Atlas Antibodies

Documents & Links for Anti CNN2 pAb (ATL-HPA049095)
Datasheet Anti CNN2 pAb (ATL-HPA049095) Datasheet (External Link)
Vendor Page Anti CNN2 pAb (ATL-HPA049095)