Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014263-25

Protein Description: calponin 1, basic, smooth muscle
Gene Name: CNN1
Alternative Gene Name: Sm-Calp, SMCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001349: 96%, ENSRNOG00000027736: 97%
Entrez Gene ID: 1264
Uniprot ID: P51911
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
• Gene Sequence: PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
• Gene ID - Mouse: ENSMUSG00000001349
• Gene ID - Rat: ENSRNOG00000027736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) – 1 Found

Kim, Yerin; Yu, Namhee; Jang, Ye Eun; Lee, Eunkyung; Jung, Yeonjoo; Lee, Doo Jae; Taylor, W Robert; Jo, Hanjoong; Kim, Jaesang; Lee, Sanghyuk; Kang, Sang Won. Conserved miR-370-3p/BMP-7 axis regulates the phenotypic change of human vascular smooth muscle cells. Scientific Reports. 2023;13(1):2404.