Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA014263-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CNN1
Alternative Gene Name: Sm-Calp, SMCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001349: 96%, ENSRNOG00000027736: 97%
Entrez Gene ID: 1264
Uniprot ID: P51911
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS |
| Gene Sequence | PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS |
| Gene ID - Mouse | ENSMUSG00000001349 |
| Gene ID - Rat | ENSRNOG00000027736 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) | |
| Datasheet | Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) | |
| Datasheet | Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) |
| Citations for Anti CNN1 pAb (ATL-HPA014263 w/enhanced validation) – 1 Found |
| Kim, Yerin; Yu, Namhee; Jang, Ye Eun; Lee, Eunkyung; Jung, Yeonjoo; Lee, Doo Jae; Taylor, W Robert; Jo, Hanjoong; Kim, Jaesang; Lee, Sanghyuk; Kang, Sang Won. Conserved miR-370-3p/BMP-7 axis regulates the phenotypic change of human vascular smooth muscle cells. Scientific Reports. 2023;13(1):2404. PubMed |