Anti CNKSR3 pAb (ATL-HPA049651)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049651-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CNKSR3
Alternative Gene Name: FLJ31349, MAGI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015202: 93%, ENSRNOG00000018052: 92%
Entrez Gene ID: 154043
Uniprot ID: Q6P9H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIP |
| Gene Sequence | FLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIP |
| Gene ID - Mouse | ENSMUSG00000015202 |
| Gene ID - Rat | ENSRNOG00000018052 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNKSR3 pAb (ATL-HPA049651) | |
| Datasheet | Anti CNKSR3 pAb (ATL-HPA049651) Datasheet (External Link) |
| Vendor Page | Anti CNKSR3 pAb (ATL-HPA049651) at Atlas Antibodies |
| Documents & Links for Anti CNKSR3 pAb (ATL-HPA049651) | |
| Datasheet | Anti CNKSR3 pAb (ATL-HPA049651) Datasheet (External Link) |
| Vendor Page | Anti CNKSR3 pAb (ATL-HPA049651) |