Anti CNKSR1 pAb (ATL-HPA030847)

Atlas Antibodies

SKU: ATL-HPA030847-25

• 
• 
• 

Protein Description: connector enhancer of kinase suppressor of Ras 1
Gene Name: CNKSR1
Alternative Gene Name: CNK, CNK1, KSR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028841: 86%, ENSRNOG00000022838: 90%
Entrez Gene ID: 10256
Uniprot ID: Q969H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRE
• Gene Sequence: SPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRE
• Gene ID - Mouse: ENSMUSG00000028841
• Gene ID - Rat: ENSRNOG00000022838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.