Anti CNIH4 pAb (ATL-HPA044268)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044268-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CNIH4
Alternative Gene Name: HSPC163
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062169: 97%, ENSRNOG00000003717: 97%
Entrez Gene ID: 29097
Uniprot ID: Q9P003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSH |
Gene Sequence | VATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSH |
Gene ID - Mouse | ENSMUSG00000062169 |
Gene ID - Rat | ENSRNOG00000003717 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNIH4 pAb (ATL-HPA044268) | |
Datasheet | Anti CNIH4 pAb (ATL-HPA044268) Datasheet (External Link) |
Vendor Page | Anti CNIH4 pAb (ATL-HPA044268) at Atlas Antibodies |
Documents & Links for Anti CNIH4 pAb (ATL-HPA044268) | |
Datasheet | Anti CNIH4 pAb (ATL-HPA044268) Datasheet (External Link) |
Vendor Page | Anti CNIH4 pAb (ATL-HPA044268) |