Anti CNIH4 pAb (ATL-HPA044268)

Atlas Antibodies

Catalog No.:
ATL-HPA044268-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cornichon family AMPA receptor auxiliary protein 4
Gene Name: CNIH4
Alternative Gene Name: HSPC163
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062169: 97%, ENSRNOG00000003717: 97%
Entrez Gene ID: 29097
Uniprot ID: Q9P003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSH
Gene Sequence VATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSH
Gene ID - Mouse ENSMUSG00000062169
Gene ID - Rat ENSRNOG00000003717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNIH4 pAb (ATL-HPA044268)
Datasheet Anti CNIH4 pAb (ATL-HPA044268) Datasheet (External Link)
Vendor Page Anti CNIH4 pAb (ATL-HPA044268) at Atlas Antibodies

Documents & Links for Anti CNIH4 pAb (ATL-HPA044268)
Datasheet Anti CNIH4 pAb (ATL-HPA044268) Datasheet (External Link)
Vendor Page Anti CNIH4 pAb (ATL-HPA044268)