Anti CNIH1 pAb (ATL-HPA002544)

Atlas Antibodies

SKU: ATL-HPA002544-25

• 

Protein Description: cornichon family AMPA receptor auxiliary protein 1
Gene Name: CNIH1
Alternative Gene Name: CNIH, CNIL, TGAM77
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015759: 100%, ENSRNOG00000009811: 100%
Entrez Gene ID: 10175
Uniprot ID: O95406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKL
• Gene Sequence: LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKL
• Gene ID - Mouse: ENSMUSG00000015759
• Gene ID - Rat: ENSRNOG00000009811
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.