Anti CNGA3 pAb (ATL-HPA049378)

Atlas Antibodies

Catalog No.:
ATL-HPA049378-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclic nucleotide gated channel alpha 3
Gene Name: CNGA3
Alternative Gene Name: ACHM2, CCNC1, CCNCa, CNCG3, CNG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026114: 45%, ENSRNOG00000051950: 49%
Entrez Gene ID: 1261
Uniprot ID: Q16281
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEK
Gene Sequence FLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEK
Gene ID - Mouse ENSMUSG00000026114
Gene ID - Rat ENSRNOG00000051950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNGA3 pAb (ATL-HPA049378)
Datasheet Anti CNGA3 pAb (ATL-HPA049378) Datasheet (External Link)
Vendor Page Anti CNGA3 pAb (ATL-HPA049378) at Atlas Antibodies

Documents & Links for Anti CNGA3 pAb (ATL-HPA049378)
Datasheet Anti CNGA3 pAb (ATL-HPA049378) Datasheet (External Link)
Vendor Page Anti CNGA3 pAb (ATL-HPA049378)