Anti CNGA2 pAb (ATL-HPA015065)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015065-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CNGA2
Alternative Gene Name: CNCA, CNCA1, CNG2, FLJ46312, OCNC1, OCNCa, OCNCALPHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005864: 94%, ENSRNOG00000030119: 93%
Entrez Gene ID: 1260
Uniprot ID: Q16280
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSP |
| Gene Sequence | EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSP |
| Gene ID - Mouse | ENSMUSG00000005864 |
| Gene ID - Rat | ENSRNOG00000030119 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNGA2 pAb (ATL-HPA015065) | |
| Datasheet | Anti CNGA2 pAb (ATL-HPA015065) Datasheet (External Link) |
| Vendor Page | Anti CNGA2 pAb (ATL-HPA015065) at Atlas Antibodies |
| Documents & Links for Anti CNGA2 pAb (ATL-HPA015065) | |
| Datasheet | Anti CNGA2 pAb (ATL-HPA015065) Datasheet (External Link) |
| Vendor Page | Anti CNGA2 pAb (ATL-HPA015065) |