Anti CNGA2 pAb (ATL-HPA015065)

Atlas Antibodies

SKU:
ATL-HPA015065-25
  • Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclic nucleotide gated channel alpha 2
Gene Name: CNGA2
Alternative Gene Name: CNCA, CNCA1, CNG2, FLJ46312, OCNC1, OCNCa, OCNCALPHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005864: 94%, ENSRNOG00000030119: 93%
Entrez Gene ID: 1260
Uniprot ID: Q16280
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSP
Gene Sequence EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSP
Gene ID - Mouse ENSMUSG00000005864
Gene ID - Rat ENSRNOG00000030119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNGA2 pAb (ATL-HPA015065)
Datasheet Anti CNGA2 pAb (ATL-HPA015065) Datasheet (External Link)
Vendor Page Anti CNGA2 pAb (ATL-HPA015065) at Atlas Antibodies

Documents & Links for Anti CNGA2 pAb (ATL-HPA015065)
Datasheet Anti CNGA2 pAb (ATL-HPA015065) Datasheet (External Link)
Vendor Page Anti CNGA2 pAb (ATL-HPA015065)