Anti CNFN pAb (ATL-HPA053997)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053997-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CNFN
Alternative Gene Name: PLAC8L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063651: 98%, ENSRNOG00000020530: 98%
Entrez Gene ID: 84518
Uniprot ID: Q9BYD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR |
| Gene Sequence | FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR |
| Gene ID - Mouse | ENSMUSG00000063651 |
| Gene ID - Rat | ENSRNOG00000020530 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNFN pAb (ATL-HPA053997) | |
| Datasheet | Anti CNFN pAb (ATL-HPA053997) Datasheet (External Link) |
| Vendor Page | Anti CNFN pAb (ATL-HPA053997) at Atlas Antibodies |
| Documents & Links for Anti CNFN pAb (ATL-HPA053997) | |
| Datasheet | Anti CNFN pAb (ATL-HPA053997) Datasheet (External Link) |
| Vendor Page | Anti CNFN pAb (ATL-HPA053997) |