Anti CNFN pAb (ATL-HPA053997)

Atlas Antibodies

Catalog No.:
ATL-HPA053997-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cornifelin
Gene Name: CNFN
Alternative Gene Name: PLAC8L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063651: 98%, ENSRNOG00000020530: 98%
Entrez Gene ID: 84518
Uniprot ID: Q9BYD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR
Gene Sequence FGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIR
Gene ID - Mouse ENSMUSG00000063651
Gene ID - Rat ENSRNOG00000020530
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNFN pAb (ATL-HPA053997)
Datasheet Anti CNFN pAb (ATL-HPA053997) Datasheet (External Link)
Vendor Page Anti CNFN pAb (ATL-HPA053997) at Atlas Antibodies

Documents & Links for Anti CNFN pAb (ATL-HPA053997)
Datasheet Anti CNFN pAb (ATL-HPA053997) Datasheet (External Link)
Vendor Page Anti CNFN pAb (ATL-HPA053997)