Anti CNEP1R1 pAb (ATL-HPA077906)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077906-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CNEP1R1
Alternative Gene Name: C16orf69, FLJ38101, NEP1-R1, TMEM188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036810: 100%, ENSRNOG00000015534: 100%
Entrez Gene ID: 255919
Uniprot ID: Q8N9A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ |
| Gene Sequence | HKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ |
| Gene ID - Mouse | ENSMUSG00000036810 |
| Gene ID - Rat | ENSRNOG00000015534 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNEP1R1 pAb (ATL-HPA077906) | |
| Datasheet | Anti CNEP1R1 pAb (ATL-HPA077906) Datasheet (External Link) |
| Vendor Page | Anti CNEP1R1 pAb (ATL-HPA077906) at Atlas Antibodies |
| Documents & Links for Anti CNEP1R1 pAb (ATL-HPA077906) | |
| Datasheet | Anti CNEP1R1 pAb (ATL-HPA077906) Datasheet (External Link) |
| Vendor Page | Anti CNEP1R1 pAb (ATL-HPA077906) |