Anti CNEP1R1 pAb (ATL-HPA042815)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042815-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CNEP1R1
Alternative Gene Name: C16orf69, FLJ38101, NEP1-R1, TMEM188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036810: 97%, ENSRNOG00000015534: 85%
Entrez Gene ID: 255919
Uniprot ID: Q8N9A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRSVLLHII |
Gene Sequence | MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRSVLLHII |
Gene ID - Mouse | ENSMUSG00000036810 |
Gene ID - Rat | ENSRNOG00000015534 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNEP1R1 pAb (ATL-HPA042815) | |
Datasheet | Anti CNEP1R1 pAb (ATL-HPA042815) Datasheet (External Link) |
Vendor Page | Anti CNEP1R1 pAb (ATL-HPA042815) at Atlas Antibodies |
Documents & Links for Anti CNEP1R1 pAb (ATL-HPA042815) | |
Datasheet | Anti CNEP1R1 pAb (ATL-HPA042815) Datasheet (External Link) |
Vendor Page | Anti CNEP1R1 pAb (ATL-HPA042815) |