Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008933-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carnosine dipeptidase 1 (metallopeptidase M20 family)
Gene Name: CNDP1
Alternative Gene Name: CN1, CPGL2, HsT2308, MGC10825
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056162: 79%, ENSRNOG00000027739: 80%
Entrez Gene ID: 84735
Uniprot ID: Q96KN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
Gene Sequence PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
Gene ID - Mouse ENSMUSG00000056162
Gene ID - Rat ENSRNOG00000027739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation)
Datasheet Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation)
Datasheet Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation)
Citations for Anti CNDP1 pAb (ATL-HPA008933 w/enhanced validation) – 6 Found
Peters, Verena; Kebbewar, Moustafa; Jansen, Erwin W; Jakobs, Cornelis; Riedl, Eva; Koeppel, Hannes; Frey, Dirk; Adelmann, Katja; Klingbeil, Kristina; Mack, Matthias; Hoffmann, Georg F; Janssen, Bart; Zschocke, Johannes; Yard, Benito A. Relevance of allosteric conformations and homocarnosine concentration on carnosinase activity. Amino Acids. 2010;38(5):1607-15.  PubMed
Schwenk, Jochen M; Igel, Ulrika; Neiman, Maja; Langen, Hanno; Becker, Charlotte; Bjartell, Anders; Ponten, Fredrik; Wiklund, Fredrik; Grönberg, Henrik; Nilsson, Peter; Uhlen, Mathias. Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays. Molecular & Cellular Proteomics : Mcp. 2010;9(11):2497-507.  PubMed
Hjelm, Barbara; Forsström, Björn; Igel, Ulrika; Johannesson, Henrik; Stadler, Charlotte; Lundberg, Emma; Ponten, Fredrik; Sjöberg, Anna; Rockberg, Johan; Schwenk, Jochen M; Nilsson, Peter; Johansson, Christine; Uhlén, Mathias. Generation of monospecific antibodies based on affinity capture of polyclonal antibodies. Protein Science : A Publication Of The Protein Society. 2011;20(11):1824-35.  PubMed
Adelmann, Katja; Frey, Dirk; Riedl, Eva; Koeppel, Hannes; Pfister, Frederick; Peters, Verena; Schmitt, Claus P; Sternik, Paula; Hofmann, Stephanie; Zentgraf, Hans Walter; Navis, Gerjan; van den Born, Jacob; Bakker, Stephan J L; Krämer, Bernhard K; Yard, Benito A; Hauske, Sibylle J. Different conformational forms of serum carnosinase detected by a newly developed sandwich ELISA for the measurements of carnosinase concentrations. Amino Acids. 2012;43(1):143-51.  PubMed
Arner, Peter; Henjes, Frauke; Schwenk, Jochen M; Darmanis, Spyros; Dahlman, Ingrid; Iresjö, Britt-Marie; Naredi, Peter; Agustsson, Thorhallur; Lundholm, Kent; Nilsson, Peter; Rydén, Mikael. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. Plos One. 10(4):e0123566.  PubMed
Zhou, Zhou; Liu, Xue-Qi; Zhang, Shi-Qi; Qi, Xiang-Ming; Zhang, Qiu; Yard, Benito; Wu, Yong-Gui. Correlation between serum carnosinase concentration and renal damage in diabetic nephropathy patients. Amino Acids. 2021;53(5):687-700.  PubMed