Anti CNBP pAb (ATL-HPA063097)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063097-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CNBP
Alternative Gene Name: CNBP1, DM2, RNF163, ZCCHC22, ZNF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030057: 100%, ENSRNOG00000010239: 100%
Entrez Gene ID: 7555
Uniprot ID: P62633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG |
| Gene Sequence | GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG |
| Gene ID - Mouse | ENSMUSG00000030057 |
| Gene ID - Rat | ENSRNOG00000010239 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNBP pAb (ATL-HPA063097) | |
| Datasheet | Anti CNBP pAb (ATL-HPA063097) Datasheet (External Link) |
| Vendor Page | Anti CNBP pAb (ATL-HPA063097) at Atlas Antibodies |
| Documents & Links for Anti CNBP pAb (ATL-HPA063097) | |
| Datasheet | Anti CNBP pAb (ATL-HPA063097) Datasheet (External Link) |
| Vendor Page | Anti CNBP pAb (ATL-HPA063097) |