Anti CNBP pAb (ATL-HPA063097)
Atlas Antibodies
- SKU:
- ATL-HPA063097-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CNBP
Alternative Gene Name: CNBP1, DM2, RNF163, ZCCHC22, ZNF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030057: 100%, ENSRNOG00000010239: 100%
Entrez Gene ID: 7555
Uniprot ID: P62633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG |
Gene Sequence | GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG |
Gene ID - Mouse | ENSMUSG00000030057 |
Gene ID - Rat | ENSRNOG00000010239 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNBP pAb (ATL-HPA063097) | |
Datasheet | Anti CNBP pAb (ATL-HPA063097) Datasheet (External Link) |
Vendor Page | Anti CNBP pAb (ATL-HPA063097) at Atlas Antibodies |
Documents & Links for Anti CNBP pAb (ATL-HPA063097) | |
Datasheet | Anti CNBP pAb (ATL-HPA063097) Datasheet (External Link) |
Vendor Page | Anti CNBP pAb (ATL-HPA063097) |