Anti CNBP pAb (ATL-HPA063097)

Atlas Antibodies

Catalog No.: ATL-HPA063097-25

Protein Description: CCHC-type zinc finger, nucleic acid binding protein
Gene Name: CNBP
Alternative Gene Name: CNBP1, DM2, RNF163, ZCCHC22, ZNF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030057: 100%, ENSRNOG00000010239: 100%
Entrez Gene ID: 7555
Uniprot ID: P62633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
• Gene Sequence: GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
• Gene ID - Mouse: ENSMUSG00000030057
• Gene ID - Rat: ENSRNOG00000010239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.