Anti CNBP pAb (ATL-HPA063097)

Atlas Antibodies

Catalog No.:
ATL-HPA063097-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CCHC-type zinc finger, nucleic acid binding protein
Gene Name: CNBP
Alternative Gene Name: CNBP1, DM2, RNF163, ZCCHC22, ZNF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030057: 100%, ENSRNOG00000010239: 100%
Entrez Gene ID: 7555
Uniprot ID: P62633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Gene Sequence GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Gene ID - Mouse ENSMUSG00000030057
Gene ID - Rat ENSRNOG00000010239
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNBP pAb (ATL-HPA063097)
Datasheet Anti CNBP pAb (ATL-HPA063097) Datasheet (External Link)
Vendor Page Anti CNBP pAb (ATL-HPA063097) at Atlas Antibodies

Documents & Links for Anti CNBP pAb (ATL-HPA063097)
Datasheet Anti CNBP pAb (ATL-HPA063097) Datasheet (External Link)
Vendor Page Anti CNBP pAb (ATL-HPA063097)