Anti CNBD2 pAb (ATL-HPA043182)

Atlas Antibodies

SKU:
ATL-HPA043182-100
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cyclic nucleotide binding domain containing 2
Gene Name: CNBD2
Alternative Gene Name: C20orf152, CNMPD1, dJ954P9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038085: 75%, ENSRNOG00000019992: 80%
Entrez Gene ID: 140894
Uniprot ID: Q96M20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRVCKMFRQGLRGFREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSHRNYAEPLQLLLAKVMRFERFGR
Gene Sequence IRVCKMFRQGLRGFREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSHRNYAEPLQLLLAKVMRFERFGR
Gene ID - Mouse ENSMUSG00000038085
Gene ID - Rat ENSRNOG00000019992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNBD2 pAb (ATL-HPA043182)
Datasheet Anti CNBD2 pAb (ATL-HPA043182) Datasheet (External Link)
Vendor Page Anti CNBD2 pAb (ATL-HPA043182) at Atlas Antibodies

Documents & Links for Anti CNBD2 pAb (ATL-HPA043182)
Datasheet Anti CNBD2 pAb (ATL-HPA043182) Datasheet (External Link)
Vendor Page Anti CNBD2 pAb (ATL-HPA043182)