Anti CNBD2 pAb (ATL-HPA043182)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043182-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CNBD2
Alternative Gene Name: C20orf152, CNMPD1, dJ954P9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038085: 75%, ENSRNOG00000019992: 80%
Entrez Gene ID: 140894
Uniprot ID: Q96M20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRVCKMFRQGLRGFREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSHRNYAEPLQLLLAKVMRFERFGR |
Gene Sequence | IRVCKMFRQGLRGFREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSHRNYAEPLQLLLAKVMRFERFGR |
Gene ID - Mouse | ENSMUSG00000038085 |
Gene ID - Rat | ENSRNOG00000019992 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNBD2 pAb (ATL-HPA043182) | |
Datasheet | Anti CNBD2 pAb (ATL-HPA043182) Datasheet (External Link) |
Vendor Page | Anti CNBD2 pAb (ATL-HPA043182) at Atlas Antibodies |
Documents & Links for Anti CNBD2 pAb (ATL-HPA043182) | |
Datasheet | Anti CNBD2 pAb (ATL-HPA043182) Datasheet (External Link) |
Vendor Page | Anti CNBD2 pAb (ATL-HPA043182) |