Anti CNBD1 pAb (ATL-HPA025037)

Atlas Antibodies

SKU:
ATL-HPA025037-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclic nucleotide binding domain containing 1
Gene Name: CNBD1
Alternative Gene Name: FLJ35802
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073991: 51%, ENSRNOG00000056330: 53%
Entrez Gene ID: 168975
Uniprot ID: Q8NA66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSKHINYGQLNALCHIRGQHSRSMSNILSAHDTFMKQYPKVFLHQKPRLPKLFKQEEQRELNEGKEESQHQQPDDSNNI
Gene Sequence KSKHINYGQLNALCHIRGQHSRSMSNILSAHDTFMKQYPKVFLHQKPRLPKLFKQEEQRELNEGKEESQHQQPDDSNNI
Gene ID - Mouse ENSMUSG00000073991
Gene ID - Rat ENSRNOG00000056330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNBD1 pAb (ATL-HPA025037)
Datasheet Anti CNBD1 pAb (ATL-HPA025037) Datasheet (External Link)
Vendor Page Anti CNBD1 pAb (ATL-HPA025037) at Atlas Antibodies

Documents & Links for Anti CNBD1 pAb (ATL-HPA025037)
Datasheet Anti CNBD1 pAb (ATL-HPA025037) Datasheet (External Link)
Vendor Page Anti CNBD1 pAb (ATL-HPA025037)