Anti CMYA5 pAb (ATL-HPA074081)

Atlas Antibodies

Catalog No.:
ATL-HPA074081-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cardiomyopathy associated 5
Gene Name: CMYA5
Alternative Gene Name: C5orf10, DKFZp451G223, myospryn, SPRYD2, TRIM76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047419: 54%, ENSRNOG00000023803: 58%
Entrez Gene ID: 202333
Uniprot ID: Q8N3K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDVPKQSVLVSKHHLEAAEDTRVKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLS
Gene Sequence SDVPKQSVLVSKHHLEAAEDTRVKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLS
Gene ID - Mouse ENSMUSG00000047419
Gene ID - Rat ENSRNOG00000023803
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMYA5 pAb (ATL-HPA074081)
Datasheet Anti CMYA5 pAb (ATL-HPA074081) Datasheet (External Link)
Vendor Page Anti CMYA5 pAb (ATL-HPA074081) at Atlas Antibodies

Documents & Links for Anti CMYA5 pAb (ATL-HPA074081)
Datasheet Anti CMYA5 pAb (ATL-HPA074081) Datasheet (External Link)
Vendor Page Anti CMYA5 pAb (ATL-HPA074081)