Anti CMTR2 pAb (ATL-HPA048265)

Atlas Antibodies

Catalog No.:
ATL-HPA048265-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cap methyltransferase 2
Gene Name: CMTR2
Alternative Gene Name: AFT, FLJ11171, FTSJD1, MTr2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046441: 76%, ENSRNOG00000017102: 75%
Entrez Gene ID: 55783
Uniprot ID: Q8IYT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCH
Gene Sequence DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCH
Gene ID - Mouse ENSMUSG00000046441
Gene ID - Rat ENSRNOG00000017102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMTR2 pAb (ATL-HPA048265)
Datasheet Anti CMTR2 pAb (ATL-HPA048265) Datasheet (External Link)
Vendor Page Anti CMTR2 pAb (ATL-HPA048265) at Atlas Antibodies

Documents & Links for Anti CMTR2 pAb (ATL-HPA048265)
Datasheet Anti CMTR2 pAb (ATL-HPA048265) Datasheet (External Link)
Vendor Page Anti CMTR2 pAb (ATL-HPA048265)
Citations for Anti CMTR2 pAb (ATL-HPA048265) – 1 Found
Drazkowska, Karolina; Tomecki, Rafal; Warminski, Marcin; Baran, Natalia; Cysewski, Dominik; Depaix, Anaïs; Kasprzyk, Renata; Kowalska, Joanna; Jemielity, Jacek; Sikorski, Pawel J. 2'-O-Methylation of the second transcribed nucleotide within the mRNA 5' cap impacts the protein production level in a cell-specific manner and contributes to RNA immune evasion. Nucleic Acids Research. 2022;50(16):9051-9071.  PubMed