Anti CMTR2 pAb (ATL-HPA041700)

Atlas Antibodies

SKU:
ATL-HPA041700-25
  • Immunohistochemical staining of human testis shows strong positivity in spematogonia in seminiferous ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cap methyltransferase 2
Gene Name: CMTR2
Alternative Gene Name: AFT, FLJ11171, FTSJD1, MTr2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046441: 84%, ENSRNOG00000017102: 81%
Entrez Gene ID: 55783
Uniprot ID: Q8IYT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRHEECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLVK
Gene Sequence AIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRHEECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLVK
Gene ID - Mouse ENSMUSG00000046441
Gene ID - Rat ENSRNOG00000017102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CMTR2 pAb (ATL-HPA041700)
Datasheet Anti CMTR2 pAb (ATL-HPA041700) Datasheet (External Link)
Vendor Page Anti CMTR2 pAb (ATL-HPA041700) at Atlas Antibodies

Documents & Links for Anti CMTR2 pAb (ATL-HPA041700)
Datasheet Anti CMTR2 pAb (ATL-HPA041700) Datasheet (External Link)
Vendor Page Anti CMTR2 pAb (ATL-HPA041700)