Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029980-25

• 
• 
• 

Protein Description: cap methyltransferase 1
Gene Name: CMTR1
Alternative Gene Name: FTSJD2, ISG95, KIAA0082, MTr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024019: 91%, ENSRNOG00000000532: 89%
Entrez Gene ID: 23070
Uniprot ID: Q8N1G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS
• Gene Sequence: DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS
• Gene ID - Mouse: ENSMUSG00000024019
• Gene ID - Rat: ENSRNOG00000000532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) – 2 Found

Williams, Graham D; Gokhale, Nandan S; Snider, Daltry L; Horner, Stacy M. The mRNA Cap 2'-O-Methyltransferase CMTR1 Regulates the Expression of Certain Interferon-Stimulated Genes. Msphere. 2020;5(3) 

Drazkowska, Karolina; Tomecki, Rafal; Warminski, Marcin; Baran, Natalia; Cysewski, Dominik; Depaix, Anaïs; Kasprzyk, Renata; Kowalska, Joanna; Jemielity, Jacek; Sikorski, Pawel J. 2'-O-Methylation of the second transcribed nucleotide within the mRNA 5' cap impacts the protein production level in a cell-specific manner and contributes to RNA immune evasion. Nucleic Acids Research. 2022;50(16):9051-9071.