Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029980-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cap methyltransferase 1
Gene Name: CMTR1
Alternative Gene Name: FTSJD2, ISG95, KIAA0082, MTr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024019: 91%, ENSRNOG00000000532: 89%
Entrez Gene ID: 23070
Uniprot ID: Q8N1G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS
Gene Sequence DDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKS
Gene ID - Mouse ENSMUSG00000024019
Gene ID - Rat ENSRNOG00000000532
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation)
Datasheet Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation)
Datasheet Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation)
Citations for Anti CMTR1 pAb (ATL-HPA029980 w/enhanced validation) – 2 Found
Williams, Graham D; Gokhale, Nandan S; Snider, Daltry L; Horner, Stacy M. The mRNA Cap 2'-O-Methyltransferase CMTR1 Regulates the Expression of Certain Interferon-Stimulated Genes. Msphere. 2020;5(3)  PubMed
Drazkowska, Karolina; Tomecki, Rafal; Warminski, Marcin; Baran, Natalia; Cysewski, Dominik; Depaix, Anaïs; Kasprzyk, Renata; Kowalska, Joanna; Jemielity, Jacek; Sikorski, Pawel J. 2'-O-Methylation of the second transcribed nucleotide within the mRNA 5' cap impacts the protein production level in a cell-specific manner and contributes to RNA immune evasion. Nucleic Acids Research. 2022;50(16):9051-9071.  PubMed