Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029954-100
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-CMTR1 antibody. Corresponding CMTR1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CMTR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414851).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cap methyltransferase 1
Gene Name: CMTR1
Alternative Gene Name: FTSJD2, ISG95, KIAA0082, MTr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024019: 91%, ENSRNOG00000000532: 90%
Entrez Gene ID: 23070
Uniprot ID: Q8N1G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL
Gene Sequence GKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL
Gene ID - Mouse ENSMUSG00000024019
Gene ID - Rat ENSRNOG00000000532
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation)
Datasheet Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation)
Datasheet Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMTR1 pAb (ATL-HPA029954 w/enhanced validation)