Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023890-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: CKLF-like MARVEL transmembrane domain containing 4
Gene Name: CMTM4
Alternative Gene Name: CKLFSF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096188: 100%, ENSRNOG00000011009: 100%
Entrez Gene ID: 146223
Uniprot ID: Q8IZR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL
Gene Sequence GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL
Gene ID - Mouse ENSMUSG00000096188
Gene ID - Rat ENSRNOG00000011009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation)
Datasheet Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation)
Datasheet Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation)