Anti CMTM4 pAb (ATL-HPA023890 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023890-25

Protein Description: CKLF-like MARVEL transmembrane domain containing 4
Gene Name: CMTM4
Alternative Gene Name: CKLFSF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096188: 100%, ENSRNOG00000011009: 100%
Entrez Gene ID: 146223
Uniprot ID: Q8IZR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL
• Gene Sequence: GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL
• Gene ID - Mouse: ENSMUSG00000096188
• Gene ID - Rat: ENSRNOG00000011009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.