Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA014704-25

• 
• 

Protein Description: CKLF-like MARVEL transmembrane domain containing 4
Gene Name: CMTM4
Alternative Gene Name: CKLFSF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096188: 59%, ENSRNOG00000011009: 54%
Entrez Gene ID: 146223
Uniprot ID: Q8IZR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ
• Gene Sequence: KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ
• Gene ID - Mouse: ENSMUSG00000096188
• Gene ID - Rat: ENSRNOG00000011009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CMTM4 pAb (ATL-HPA014704 w/enhanced validation) – 2 Found

Mezzadra, Riccardo; Sun, Chong; Jae, Lucas T; Gomez-Eerland, Raquel; de Vries, Evert; Wu, Wei; Logtenberg, Meike E W; Slagter, Maarten; Rozeman, Elisa A; Hofland, Ingrid; Broeks, Annegien; Horlings, Hugo M; Wessels, Lodewyk F A; Blank, Christian U; Xiao, Yanling; Heck, Albert J R; Borst, Jannie; Brummelkamp, Thijn R; Schumacher, Ton N M. Identification of CMTM6 and CMTM4 as PD-L1 protein regulators. Nature. 2017;549(7670):106-110. 

Knizkova, Daniela; Pribikova, Michaela; Draberova, Helena; Semberova, Tereza; Trivic, Tijana; Synackova, Alzbeta; Ujevic, Andrea; Stefanovic, Jana; Drobek, Ales; Huranova, Martina; Niederlova, Veronika; Tsyklauri, Oksana; Neuwirth, Ales; Tureckova, Jolana; Stepanek, Ondrej; Draber, Peter. CMTM4 is a subunit of the IL-17 receptor and mediates autoimmune pathology. Nature Immunology. 2022;23(11):1644-1652.