Anti CMSS1 pAb (ATL-HPA042820)

Atlas Antibodies

SKU:
ATL-HPA042820-25
  • Immunohistochemical staining of human pancreas shows moderate nucleolar positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cms1 ribosomal small subunit homolog (yeast)
Gene Name: CMSS1
Alternative Gene Name: C3orf26, MGC4308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022748: 68%, ENSRNOG00000027888: 54%
Entrez Gene ID: 84319
Uniprot ID: Q9BQ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKP
Gene Sequence DEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKP
Gene ID - Mouse ENSMUSG00000022748
Gene ID - Rat ENSRNOG00000027888
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CMSS1 pAb (ATL-HPA042820)
Datasheet Anti CMSS1 pAb (ATL-HPA042820) Datasheet (External Link)
Vendor Page Anti CMSS1 pAb (ATL-HPA042820) at Atlas Antibodies

Documents & Links for Anti CMSS1 pAb (ATL-HPA042820)
Datasheet Anti CMSS1 pAb (ATL-HPA042820) Datasheet (External Link)
Vendor Page Anti CMSS1 pAb (ATL-HPA042820)