Anti CMSS1 pAb (ATL-HPA042820)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042820-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CMSS1
Alternative Gene Name: C3orf26, MGC4308
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022748: 68%, ENSRNOG00000027888: 54%
Entrez Gene ID: 84319
Uniprot ID: Q9BQ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKP |
Gene Sequence | DEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKP |
Gene ID - Mouse | ENSMUSG00000022748 |
Gene ID - Rat | ENSRNOG00000027888 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CMSS1 pAb (ATL-HPA042820) | |
Datasheet | Anti CMSS1 pAb (ATL-HPA042820) Datasheet (External Link) |
Vendor Page | Anti CMSS1 pAb (ATL-HPA042820) at Atlas Antibodies |
Documents & Links for Anti CMSS1 pAb (ATL-HPA042820) | |
Datasheet | Anti CMSS1 pAb (ATL-HPA042820) Datasheet (External Link) |
Vendor Page | Anti CMSS1 pAb (ATL-HPA042820) |