Anti CMPK1 pAb (ATL-HPA058604)

Atlas Antibodies

Catalog No.:
ATL-HPA058604-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cytidine monophosphate (UMP-CMP) kinase 1, cytosolic
Gene Name: CMPK1
Alternative Gene Name: CMPK, UMP-CMPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028719: 100%, ENSRNOG00000007775: 100%
Entrez Gene ID: 51727
Uniprot ID: P30085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN
Gene Sequence LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN
Gene ID - Mouse ENSMUSG00000028719
Gene ID - Rat ENSRNOG00000007775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMPK1 pAb (ATL-HPA058604)
Datasheet Anti CMPK1 pAb (ATL-HPA058604) Datasheet (External Link)
Vendor Page Anti CMPK1 pAb (ATL-HPA058604) at Atlas Antibodies

Documents & Links for Anti CMPK1 pAb (ATL-HPA058604)
Datasheet Anti CMPK1 pAb (ATL-HPA058604) Datasheet (External Link)
Vendor Page Anti CMPK1 pAb (ATL-HPA058604)