Anti CMPK1 pAb (ATL-HPA058604)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058604-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: CMPK1
Alternative Gene Name: CMPK, UMP-CMPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028719: 100%, ENSRNOG00000007775: 100%
Entrez Gene ID: 51727
Uniprot ID: P30085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN |
| Gene Sequence | LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN |
| Gene ID - Mouse | ENSMUSG00000028719 |
| Gene ID - Rat | ENSRNOG00000007775 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMPK1 pAb (ATL-HPA058604) | |
| Datasheet | Anti CMPK1 pAb (ATL-HPA058604) Datasheet (External Link) |
| Vendor Page | Anti CMPK1 pAb (ATL-HPA058604) at Atlas Antibodies |
| Documents & Links for Anti CMPK1 pAb (ATL-HPA058604) | |
| Datasheet | Anti CMPK1 pAb (ATL-HPA058604) Datasheet (External Link) |
| Vendor Page | Anti CMPK1 pAb (ATL-HPA058604) |