Anti CMKLR1 pAb (ATL-HPA047865)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047865-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CMKLR1
Alternative Gene Name: RVER1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042190: 80%, ENSRNOG00000000704: 82%
Entrez Gene ID: 1240
Uniprot ID: Q99788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG |
| Gene Sequence | QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG |
| Gene ID - Mouse | ENSMUSG00000042190 |
| Gene ID - Rat | ENSRNOG00000000704 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMKLR1 pAb (ATL-HPA047865) | |
| Datasheet | Anti CMKLR1 pAb (ATL-HPA047865) Datasheet (External Link) |
| Vendor Page | Anti CMKLR1 pAb (ATL-HPA047865) at Atlas Antibodies |
| Documents & Links for Anti CMKLR1 pAb (ATL-HPA047865) | |
| Datasheet | Anti CMKLR1 pAb (ATL-HPA047865) Datasheet (External Link) |
| Vendor Page | Anti CMKLR1 pAb (ATL-HPA047865) |