Anti CMKLR1 pAb (ATL-HPA047865)

Atlas Antibodies

Catalog No.:
ATL-HPA047865-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chemokine-like receptor 1
Gene Name: CMKLR1
Alternative Gene Name: RVER1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042190: 80%, ENSRNOG00000000704: 82%
Entrez Gene ID: 1240
Uniprot ID: Q99788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG
Gene Sequence QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG
Gene ID - Mouse ENSMUSG00000042190
Gene ID - Rat ENSRNOG00000000704
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMKLR1 pAb (ATL-HPA047865)
Datasheet Anti CMKLR1 pAb (ATL-HPA047865) Datasheet (External Link)
Vendor Page Anti CMKLR1 pAb (ATL-HPA047865) at Atlas Antibodies

Documents & Links for Anti CMKLR1 pAb (ATL-HPA047865)
Datasheet Anti CMKLR1 pAb (ATL-HPA047865) Datasheet (External Link)
Vendor Page Anti CMKLR1 pAb (ATL-HPA047865)