Anti CMIP pAb (ATL-HPA066710 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066710-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
  • Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CMIP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: c-Maf inducing protein
Gene Name: CMIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034390: 100%, ENSRNOG00000013178: 100%
Entrez Gene ID: 80790
Uniprot ID: Q8IY22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNH
Gene Sequence RDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNH
Gene ID - Mouse ENSMUSG00000034390
Gene ID - Rat ENSRNOG00000013178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CMIP pAb (ATL-HPA066710 w/enhanced validation)
Datasheet Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CMIP pAb (ATL-HPA066710 w/enhanced validation)
Datasheet Anti CMIP pAb (ATL-HPA066710 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMIP pAb (ATL-HPA066710 w/enhanced validation)