Anti CMC2 pAb (ATL-HPA006871)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006871-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CMC2
Alternative Gene Name: C16orf61, DC13, MGC45036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014633: 87%, ENSRNOG00000011279: 86%
Entrez Gene ID: 56942
Uniprot ID: Q9NRP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL |
| Gene Sequence | MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL |
| Gene ID - Mouse | ENSMUSG00000014633 |
| Gene ID - Rat | ENSRNOG00000011279 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMC2 pAb (ATL-HPA006871) | |
| Datasheet | Anti CMC2 pAb (ATL-HPA006871) Datasheet (External Link) |
| Vendor Page | Anti CMC2 pAb (ATL-HPA006871) at Atlas Antibodies |
| Documents & Links for Anti CMC2 pAb (ATL-HPA006871) | |
| Datasheet | Anti CMC2 pAb (ATL-HPA006871) Datasheet (External Link) |
| Vendor Page | Anti CMC2 pAb (ATL-HPA006871) |