Anti CMC2 pAb (ATL-HPA006871)

Atlas Antibodies

SKU:
ATL-HPA006871-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: C-x(9)-C motif containing 2
Gene Name: CMC2
Alternative Gene Name: C16orf61, DC13, MGC45036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014633: 87%, ENSRNOG00000011279: 86%
Entrez Gene ID: 56942
Uniprot ID: Q9NRP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Gene Sequence MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Gene ID - Mouse ENSMUSG00000014633
Gene ID - Rat ENSRNOG00000011279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CMC2 pAb (ATL-HPA006871)
Datasheet Anti CMC2 pAb (ATL-HPA006871) Datasheet (External Link)
Vendor Page Anti CMC2 pAb (ATL-HPA006871) at Atlas Antibodies

Documents & Links for Anti CMC2 pAb (ATL-HPA006871)
Datasheet Anti CMC2 pAb (ATL-HPA006871) Datasheet (External Link)
Vendor Page Anti CMC2 pAb (ATL-HPA006871)