Anti CMC1 pAb (ATL-HPA043333)

Atlas Antibodies

Catalog No.:
ATL-HPA043333-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: C-x(9)-C motif containing 1
Gene Name: CMC1
Alternative Gene Name: C3orf68, MGC61571
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039163: 88%, ENSRNOG00000010149: 88%
Entrez Gene ID: 152100
Uniprot ID: Q7Z7K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
Gene Sequence RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
Gene ID - Mouse ENSMUSG00000039163
Gene ID - Rat ENSRNOG00000010149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMC1 pAb (ATL-HPA043333)
Datasheet Anti CMC1 pAb (ATL-HPA043333) Datasheet (External Link)
Vendor Page Anti CMC1 pAb (ATL-HPA043333) at Atlas Antibodies

Documents & Links for Anti CMC1 pAb (ATL-HPA043333)
Datasheet Anti CMC1 pAb (ATL-HPA043333) Datasheet (External Link)
Vendor Page Anti CMC1 pAb (ATL-HPA043333)
Citations for Anti CMC1 pAb (ATL-HPA043333) – 2 Found
Bourens, Myriam; Barrientos, Antoni. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. Embo Reports. 2017;18(3):477-494.  PubMed
Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.  PubMed