Anti CMBL pAb (ATL-HPA036571)

Atlas Antibodies

SKU: ATL-HPA036571-25

• 
• 

Protein Description: carboxymethylenebutenolidase homolog (Pseudomonas)
Gene Name: CMBL
Alternative Gene Name: FLJ23617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022235: 88%, ENSRNOG00000011260: 88%
Entrez Gene ID: 134147
Uniprot ID: Q96DG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG
• Gene Sequence: AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG
• Gene ID - Mouse: ENSMUSG00000022235
• Gene ID - Rat: ENSRNOG00000011260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CMBL pAb (ATL-HPA036571) – 1 Found

Dinets, Andrii; Pernemalm, Maria; Kjellin, Hanna; Sviatoha, Vitalijs; Sofiadis, Anastasios; Juhlin, C Christofer; Zedenius, Jan; Larsson, Catharina; Lehtiö, Janne; Höög, Anders. Differential protein expression profiles of cyst fluid from papillary thyroid carcinoma and benign thyroid lesions. Plos One. 10(5):e0126472.