Anti CMBL pAb (ATL-HPA036571)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036571-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/89253/162710/atl-hpa036571_anti-cmbl-pab-atl-hpa036571_44350__61004.1681114788.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue")
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CMBL
Alternative Gene Name: FLJ23617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022235: 88%, ENSRNOG00000011260: 88%
Entrez Gene ID: 134147
Uniprot ID: Q96DG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG |
| Gene Sequence | AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG |
| Gene ID - Mouse | ENSMUSG00000022235 |
| Gene ID - Rat | ENSRNOG00000011260 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CMBL pAb (ATL-HPA036571) | |
| Datasheet | Anti CMBL pAb (ATL-HPA036571) Datasheet (External Link) |
| Vendor Page | Anti CMBL pAb (ATL-HPA036571) at Atlas Antibodies |
| Documents & Links for Anti CMBL pAb (ATL-HPA036571) | |
| Datasheet | Anti CMBL pAb (ATL-HPA036571) Datasheet (External Link) |
| Vendor Page | Anti CMBL pAb (ATL-HPA036571) |
| Citations for Anti CMBL pAb (ATL-HPA036571) – 1 Found |
| Dinets, Andrii; Pernemalm, Maria; Kjellin, Hanna; Sviatoha, Vitalijs; Sofiadis, Anastasios; Juhlin, C Christofer; Zedenius, Jan; Larsson, Catharina; Lehtiö, Janne; Höög, Anders. Differential protein expression profiles of cyst fluid from papillary thyroid carcinoma and benign thyroid lesions. Plos One. 10(5):e0126472. PubMed |