Anti CMBL pAb (ATL-HPA036571)

Atlas Antibodies

Catalog No.:
ATL-HPA036571-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carboxymethylenebutenolidase homolog (Pseudomonas)
Gene Name: CMBL
Alternative Gene Name: FLJ23617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022235: 88%, ENSRNOG00000011260: 88%
Entrez Gene ID: 134147
Uniprot ID: Q96DG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG
Gene Sequence AYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNGYTTIVPDFFVG
Gene ID - Mouse ENSMUSG00000022235
Gene ID - Rat ENSRNOG00000011260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMBL pAb (ATL-HPA036571)
Datasheet Anti CMBL pAb (ATL-HPA036571) Datasheet (External Link)
Vendor Page Anti CMBL pAb (ATL-HPA036571) at Atlas Antibodies

Documents & Links for Anti CMBL pAb (ATL-HPA036571)
Datasheet Anti CMBL pAb (ATL-HPA036571) Datasheet (External Link)
Vendor Page Anti CMBL pAb (ATL-HPA036571)
Citations for Anti CMBL pAb (ATL-HPA036571) – 1 Found
Dinets, Andrii; Pernemalm, Maria; Kjellin, Hanna; Sviatoha, Vitalijs; Sofiadis, Anastasios; Juhlin, C Christofer; Zedenius, Jan; Larsson, Catharina; Lehtiö, Janne; Höög, Anders. Differential protein expression profiles of cyst fluid from papillary thyroid carcinoma and benign thyroid lesions. Plos One. 10(5):e0126472.  PubMed