Anti CMAS pAb (ATL-HPA039905)

Atlas Antibodies

Catalog No.:
ATL-HPA039905-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cytidine monophosphate N-acetylneuraminic acid synthetase
Gene Name: CMAS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030282: 91%, ENSRNOG00000013816: 91%
Entrez Gene ID: 55907
Uniprot ID: Q8NFW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ
Gene Sequence KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ
Gene ID - Mouse ENSMUSG00000030282
Gene ID - Rat ENSRNOG00000013816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMAS pAb (ATL-HPA039905)
Datasheet Anti CMAS pAb (ATL-HPA039905) Datasheet (External Link)
Vendor Page Anti CMAS pAb (ATL-HPA039905) at Atlas Antibodies

Documents & Links for Anti CMAS pAb (ATL-HPA039905)
Datasheet Anti CMAS pAb (ATL-HPA039905) Datasheet (External Link)
Vendor Page Anti CMAS pAb (ATL-HPA039905)
Citations for Anti CMAS pAb (ATL-HPA039905) – 2 Found
Teoh, Shao Thing; Ogrodzinski, Martin P; Ross, Christina; Hunter, Kent W; Lunt, Sophia Y. Sialic Acid Metabolism: A Key Player in Breast Cancer Metastasis Revealed by Metabolomics. Frontiers In Oncology. 8( 29892572):174.  PubMed
Metcalf, Kevin James; Hayward, Mary-Kate; Berens, Eric; Ironside, Alastair J; Stashko, Connor; Hwang, E Shelley; Weaver, Valerie M. Immunosuppressive glycoproteins associate with breast tumor fibrosis and aggression. Matrix Biology Plus. 2022;14( 35392183):100105.  PubMed