Anti CMAS pAb (ATL-HPA039905)

Atlas Antibodies

Catalog No.: ATL-HPA039905-25

Protein Description: cytidine monophosphate N-acetylneuraminic acid synthetase
Gene Name: CMAS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030282: 91%, ENSRNOG00000013816: 91%
Entrez Gene ID: 55907
Uniprot ID: Q8NFW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ
• Gene Sequence: KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ
• Gene ID - Mouse: ENSMUSG00000030282
• Gene ID - Rat: ENSRNOG00000013816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CMAS pAb (ATL-HPA039905) – 2 Found

Teoh, Shao Thing; Ogrodzinski, Martin P; Ross, Christina; Hunter, Kent W; Lunt, Sophia Y. Sialic Acid Metabolism: A Key Player in Breast Cancer Metastasis Revealed by Metabolomics. Frontiers In Oncology. 8( 29892572):174. 

Metcalf, Kevin James; Hayward, Mary-Kate; Berens, Eric; Ironside, Alastair J; Stashko, Connor; Hwang, E Shelley; Weaver, Valerie M. Immunosuppressive glycoproteins associate with breast tumor fibrosis and aggression. Matrix Biology Plus. 2022;14( 35392183):100105.