Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA052634-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chymase 1, mast cell
Gene Name: CMA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022225: 67%, ENSRNOG00000020563: 63%
Entrez Gene ID: 1215
Uniprot ID: P23946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Gene Sequence GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Gene ID - Mouse ENSMUSG00000022225
Gene ID - Rat ENSRNOG00000020563
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation)
Datasheet Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation)
Datasheet Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CMA1 pAb (ATL-HPA052634 w/enhanced validation)