Anti CLVS2 pAb (ATL-HPA043764)
Atlas Antibodies
- SKU:
- ATL-HPA043764-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLVS2
Alternative Gene Name: bA160A10.4, C6orf212, C6orf213, RLBP1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019785: 91%, ENSRNOG00000012122: 94%
Entrez Gene ID: 134829
Uniprot ID: Q5SYC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS |
Gene Sequence | TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS |
Gene ID - Mouse | ENSMUSG00000019785 |
Gene ID - Rat | ENSRNOG00000012122 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLVS2 pAb (ATL-HPA043764) | |
Datasheet | Anti CLVS2 pAb (ATL-HPA043764) Datasheet (External Link) |
Vendor Page | Anti CLVS2 pAb (ATL-HPA043764) at Atlas Antibodies |
Documents & Links for Anti CLVS2 pAb (ATL-HPA043764) | |
Datasheet | Anti CLVS2 pAb (ATL-HPA043764) Datasheet (External Link) |
Vendor Page | Anti CLVS2 pAb (ATL-HPA043764) |