Anti CLVS2 pAb (ATL-HPA043764)

Atlas Antibodies

Catalog No.:
ATL-HPA043764-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: clavesin 2
Gene Name: CLVS2
Alternative Gene Name: bA160A10.4, C6orf212, C6orf213, RLBP1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019785: 91%, ENSRNOG00000012122: 94%
Entrez Gene ID: 134829
Uniprot ID: Q5SYC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS
Gene Sequence TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS
Gene ID - Mouse ENSMUSG00000019785
Gene ID - Rat ENSRNOG00000012122
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLVS2 pAb (ATL-HPA043764)
Datasheet Anti CLVS2 pAb (ATL-HPA043764) Datasheet (External Link)
Vendor Page Anti CLVS2 pAb (ATL-HPA043764) at Atlas Antibodies

Documents & Links for Anti CLVS2 pAb (ATL-HPA043764)
Datasheet Anti CLVS2 pAb (ATL-HPA043764) Datasheet (External Link)
Vendor Page Anti CLVS2 pAb (ATL-HPA043764)