Anti CLVS2 pAb (ATL-HPA043764)

Atlas Antibodies

Catalog No.: ATL-HPA043764-25

Protein Description: clavesin 2
Gene Name: CLVS2
Alternative Gene Name: bA160A10.4, C6orf212, C6orf213, RLBP1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019785: 91%, ENSRNOG00000012122: 94%
Entrez Gene ID: 134829
Uniprot ID: Q5SYC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS
• Gene Sequence: TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS
• Gene ID - Mouse: ENSMUSG00000019785
• Gene ID - Rat: ENSRNOG00000012122
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.