Anti CLVS2 pAb (ATL-HPA043764)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043764-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CLVS2
Alternative Gene Name: bA160A10.4, C6orf212, C6orf213, RLBP1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019785: 91%, ENSRNOG00000012122: 94%
Entrez Gene ID: 134829
Uniprot ID: Q5SYC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS |
| Gene Sequence | TLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS |
| Gene ID - Mouse | ENSMUSG00000019785 |
| Gene ID - Rat | ENSRNOG00000012122 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLVS2 pAb (ATL-HPA043764) | |
| Datasheet | Anti CLVS2 pAb (ATL-HPA043764) Datasheet (External Link) |
| Vendor Page | Anti CLVS2 pAb (ATL-HPA043764) at Atlas Antibodies |
| Documents & Links for Anti CLVS2 pAb (ATL-HPA043764) | |
| Datasheet | Anti CLVS2 pAb (ATL-HPA043764) Datasheet (External Link) |
| Vendor Page | Anti CLVS2 pAb (ATL-HPA043764) |