Anti CLUL1 pAb (ATL-HPA075240)

Atlas Antibodies

SKU:
ATL-HPA075240-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: clusterin like 1
Gene Name: CLUL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020454: 24%, ENSRNOG00000059237: 56%
Entrez Gene ID: 27098
Uniprot ID: Q15846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK
Gene Sequence HLRNDSNSGNMKPPLLVFIVCLLWLKDSHCAPTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKK
Gene ID - Mouse ENSMUSG00000020454
Gene ID - Rat ENSRNOG00000059237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLUL1 pAb (ATL-HPA075240)
Datasheet Anti CLUL1 pAb (ATL-HPA075240) Datasheet (External Link)
Vendor Page Anti CLUL1 pAb (ATL-HPA075240) at Atlas Antibodies

Documents & Links for Anti CLUL1 pAb (ATL-HPA075240)
Datasheet Anti CLUL1 pAb (ATL-HPA075240) Datasheet (External Link)
Vendor Page Anti CLUL1 pAb (ATL-HPA075240)