Anti CLUH pAb (ATL-HPA044346)

Atlas Antibodies

Catalog No.:
ATL-HPA044346-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: clustered mitochondria (cluA/CLU1) homolog
Gene Name: CLUH
Alternative Gene Name: CLU1, KIAA0664
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020741: 99%, ENSRNOG00000002669: 99%
Entrez Gene ID: 23277
Uniprot ID: O75153
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAE
Gene Sequence LSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAE
Gene ID - Mouse ENSMUSG00000020741
Gene ID - Rat ENSRNOG00000002669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLUH pAb (ATL-HPA044346)
Datasheet Anti CLUH pAb (ATL-HPA044346) Datasheet (External Link)
Vendor Page Anti CLUH pAb (ATL-HPA044346) at Atlas Antibodies

Documents & Links for Anti CLUH pAb (ATL-HPA044346)
Datasheet Anti CLUH pAb (ATL-HPA044346) Datasheet (External Link)
Vendor Page Anti CLUH pAb (ATL-HPA044346)