Anti CLUH pAb (ATL-HPA044346)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044346-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLUH
Alternative Gene Name: CLU1, KIAA0664
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020741: 99%, ENSRNOG00000002669: 99%
Entrez Gene ID: 23277
Uniprot ID: O75153
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAE |
| Gene Sequence | LSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAE |
| Gene ID - Mouse | ENSMUSG00000020741 |
| Gene ID - Rat | ENSRNOG00000002669 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLUH pAb (ATL-HPA044346) | |
| Datasheet | Anti CLUH pAb (ATL-HPA044346) Datasheet (External Link) |
| Vendor Page | Anti CLUH pAb (ATL-HPA044346) at Atlas Antibodies |
| Documents & Links for Anti CLUH pAb (ATL-HPA044346) | |
| Datasheet | Anti CLUH pAb (ATL-HPA044346) Datasheet (External Link) |
| Vendor Page | Anti CLUH pAb (ATL-HPA044346) |