Anti CLUAP1 pAb (ATL-HPA036976)

Atlas Antibodies

Catalog No.:
ATL-HPA036976-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: clusterin associated protein 1
Gene Name: CLUAP1
Alternative Gene Name: CFAP22, FAP22, FLJ13297, KIAA0643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014232: 89%, ENSRNOG00000007117: 90%
Entrez Gene ID: 23059
Uniprot ID: Q96AJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLL
Gene Sequence VLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLL
Gene ID - Mouse ENSMUSG00000014232
Gene ID - Rat ENSRNOG00000007117
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLUAP1 pAb (ATL-HPA036976)
Datasheet Anti CLUAP1 pAb (ATL-HPA036976) Datasheet (External Link)
Vendor Page Anti CLUAP1 pAb (ATL-HPA036976) at Atlas Antibodies

Documents & Links for Anti CLUAP1 pAb (ATL-HPA036976)
Datasheet Anti CLUAP1 pAb (ATL-HPA036976) Datasheet (External Link)
Vendor Page Anti CLUAP1 pAb (ATL-HPA036976)