Anti CLUAP1 pAb (ATL-HPA036976)

Atlas Antibodies

Catalog No.: ATL-HPA036976-25

Protein Description: clusterin associated protein 1
Gene Name: CLUAP1
Alternative Gene Name: CFAP22, FAP22, FLJ13297, KIAA0643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014232: 89%, ENSRNOG00000007117: 90%
Entrez Gene ID: 23059
Uniprot ID: Q96AJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLL
• Gene Sequence: VLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLL
• Gene ID - Mouse: ENSMUSG00000014232
• Gene ID - Rat: ENSRNOG00000007117
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.