Anti CLU pAb (ATL-HPA000572 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA000572-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CLU
Alternative Gene Name: APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022037: 66%, ENSRNOG00000016460: 69%
Entrez Gene ID: 1191
Uniprot ID: P10909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS |
Gene Sequence | SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS |
Gene ID - Mouse | ENSMUSG00000022037 |
Gene ID - Rat | ENSRNOG00000016460 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLU pAb (ATL-HPA000572 w/enhanced validation) | |
Datasheet | Anti CLU pAb (ATL-HPA000572 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CLU pAb (ATL-HPA000572 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CLU pAb (ATL-HPA000572 w/enhanced validation) | |
Datasheet | Anti CLU pAb (ATL-HPA000572 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CLU pAb (ATL-HPA000572 w/enhanced validation) |
Citations for Anti CLU pAb (ATL-HPA000572 w/enhanced validation) – 3 Found |
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44. PubMed |