Anti CLTCL1 pAb (ATL-HPA075795)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075795-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CLTCL1
Alternative Gene Name: CHC22, CLH22, CLTCL, CLTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 50%, ENSRNOG00000004291: 50%
Entrez Gene ID: 8218
Uniprot ID: P53675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA |
| Gene Sequence | KSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWFLEEGKRECFA |
| Gene ID - Mouse | ENSMUSG00000047126 |
| Gene ID - Rat | ENSRNOG00000004291 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795) | |
| Datasheet | Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link) |
| Vendor Page | Anti CLTCL1 pAb (ATL-HPA075795) at Atlas Antibodies |
| Documents & Links for Anti CLTCL1 pAb (ATL-HPA075795) | |
| Datasheet | Anti CLTCL1 pAb (ATL-HPA075795) Datasheet (External Link) |
| Vendor Page | Anti CLTCL1 pAb (ATL-HPA075795) |