Anti CLTC pAb (ATL-HPA059143)

Atlas Antibodies

Catalog No.: ATL-HPA059143-25

Protein Description: clathrin, heavy chain (Hc)
Gene Name: CLTC
Alternative Gene Name: CLTCL2, Hc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 100%, ENSRNOG00000004291: 100%
Entrez Gene ID: 1213
Uniprot ID: Q00610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
• Gene Sequence: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
• Gene ID - Mouse: ENSMUSG00000047126
• Gene ID - Rat: ENSRNOG00000004291
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.