Anti CLTC pAb (ATL-HPA059143)

Atlas Antibodies

Catalog No.:
ATL-HPA059143-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: clathrin, heavy chain (Hc)
Gene Name: CLTC
Alternative Gene Name: CLTCL2, Hc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047126: 100%, ENSRNOG00000004291: 100%
Entrez Gene ID: 1213
Uniprot ID: Q00610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
Gene Sequence ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
Gene ID - Mouse ENSMUSG00000047126
Gene ID - Rat ENSRNOG00000004291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLTC pAb (ATL-HPA059143)
Datasheet Anti CLTC pAb (ATL-HPA059143) Datasheet (External Link)
Vendor Page Anti CLTC pAb (ATL-HPA059143) at Atlas Antibodies

Documents & Links for Anti CLTC pAb (ATL-HPA059143)
Datasheet Anti CLTC pAb (ATL-HPA059143) Datasheet (External Link)
Vendor Page Anti CLTC pAb (ATL-HPA059143)