Anti CLTB pAb (ATL-HPA036458 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036458-25
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles.
  • Western blot analysis in human cell line MCF-7 and human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: clathrin, light chain B
Gene Name: CLTB
Alternative Gene Name: Lcb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047547: 88%, ENSRNOG00000017506: 88%
Entrez Gene ID: 1212
Uniprot ID: P09497
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIR
Gene Sequence ENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIR
Gene ID - Mouse ENSMUSG00000047547
Gene ID - Rat ENSRNOG00000017506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLTB pAb (ATL-HPA036458 w/enhanced validation)
Datasheet Anti CLTB pAb (ATL-HPA036458 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLTB pAb (ATL-HPA036458 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLTB pAb (ATL-HPA036458 w/enhanced validation)
Datasheet Anti CLTB pAb (ATL-HPA036458 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLTB pAb (ATL-HPA036458 w/enhanced validation)