Anti CLTA pAb (ATL-HPA050918 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050918-25

Protein Description: clathrin, light chain A
Gene Name: CLTA
Alternative Gene Name: Lca
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028478: 98%, ENSRNOG00000014635: 97%
Entrez Gene ID: 1211
Uniprot ID: P09496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE
• Gene Sequence: NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE
• Gene ID - Mouse: ENSMUSG00000028478
• Gene ID - Rat: ENSRNOG00000014635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLTA pAb (ATL-HPA050918 w/enhanced validation) – 2 Found

Chen, Ping-Hung; Bendris, Nawal; Hsiao, Yi-Jing; Reis, Carlos R; Mettlen, Marcel; Chen, Hsuan-Yu; Yu, Sung-Liang; Schmid, Sandra L. Crosstalk between CLCb/Dyn1-Mediated Adaptive Clathrin-Mediated Endocytosis and Epidermal Growth Factor Receptor Signaling Increases Metastasis. Developmental Cell. 2017;40(3):278-288.e5. 

Obashi, Kazuki; Sochacki, Kem A; Strub, Marie-Paule; Taraska, Justin W. A conformational switch in clathrin light chain regulates lattice structure and endocytosis at the plasma membrane of mammalian cells. Nature Communications. 2023;14(1):732.