Anti CLRN3 pAb (ATL-HPA014482)

Atlas Antibodies

Catalog No.: ATL-HPA014482-100

Protein Description: clarin 3
Gene Name: CLRN3
Alternative Gene Name: MGC32871, TMEM12, USH3AL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050866: 61%, ENSRNOG00000028288: 63%
Entrez Gene ID: 119467
Uniprot ID: Q8NCR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDSASNGSIFITYGLFRGESSEELSHGLAEPKKKFAVLEILNNSSQ
• Gene Sequence: RDSASNGSIFITYGLFRGESSEELSHGLAEPKKKFAVLEILNNSSQ
• Gene ID - Mouse: ENSMUSG00000050866
• Gene ID - Rat: ENSRNOG00000028288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.