Anti CLRN2 pAb (ATL-HPA042407)

Atlas Antibodies

Catalog No.:
ATL-HPA042407-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: clarin 2
Gene Name: CLRN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049530: 97%, ENSRNOG00000027195: 97%
Entrez Gene ID: 645104
Uniprot ID: A0PK11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKFHDLTERIANFQEKLFQFVVVEEQYEES
Gene Sequence VKFHDLTERIANFQEKLFQFVVVEEQYEES
Gene ID - Mouse ENSMUSG00000049530
Gene ID - Rat ENSRNOG00000027195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLRN2 pAb (ATL-HPA042407)
Datasheet Anti CLRN2 pAb (ATL-HPA042407) Datasheet (External Link)
Vendor Page Anti CLRN2 pAb (ATL-HPA042407) at Atlas Antibodies

Documents & Links for Anti CLRN2 pAb (ATL-HPA042407)
Datasheet Anti CLRN2 pAb (ATL-HPA042407) Datasheet (External Link)
Vendor Page Anti CLRN2 pAb (ATL-HPA042407)
Citations for Anti CLRN2 pAb (ATL-HPA042407) – 2 Found
Dunbar, Lucy A; Patni, Pranav; Aguilar, Carlos; Mburu, Philomena; Corns, Laura; Wells, Helena Rr; Delmaghani, Sedigheh; Parker, Andrew; Johnson, Stuart; Williams, Debbie; Esapa, Christopher T; Simon, Michelle M; Chessum, Lauren; Newton, Sherylanne; Dorning, Joanne; Jeyarajan, Prashanthini; Morse, Susan; Lelli, Andrea; Codner, Gemma F; Peineau, Thibault; Gopal, Suhasini R; Alagramam, Kumar N; Hertzano, Ronna; Dulon, Didier; Wells, Sara; Williams, Frances M; Petit, Christine; Dawson, Sally J; Brown, Steve Dm; Marcotti, Walter; El-Amraoui, Aziz; Bowl, Michael R. Clarin-2 is essential for hearing by maintaining stereocilia integrity and function. Embo Molecular Medicine. 2019;11(9):e10288.  PubMed
Wells, Helena R R; Freidin, Maxim B; Zainul Abidin, Fatin N; Payton, Antony; Dawes, Piers; Munro, Kevin J; Morton, Cynthia C; Moore, David R; Dawson, Sally J; Williams, Frances M K. GWAS Identifies 44 Independent Associated Genomic Loci for Self-Reported Adult Hearing Difficulty in UK Biobank. American Journal Of Human Genetics. 2019;105(4):788-802.  PubMed