Anti CLPX pAb (ATL-HPA048199)

Atlas Antibodies

Catalog No.:
ATL-HPA048199-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: caseinolytic mitochondrial matrix peptidase chaperone subunit
Gene Name: CLPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015357: 99%, ENSRNOG00000030225: 100%
Entrez Gene ID: 10845
Uniprot ID: O76031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPS
Gene Sequence GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPS
Gene ID - Mouse ENSMUSG00000015357
Gene ID - Rat ENSRNOG00000030225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLPX pAb (ATL-HPA048199)
Datasheet Anti CLPX pAb (ATL-HPA048199) Datasheet (External Link)
Vendor Page Anti CLPX pAb (ATL-HPA048199) at Atlas Antibodies

Documents & Links for Anti CLPX pAb (ATL-HPA048199)
Datasheet Anti CLPX pAb (ATL-HPA048199) Datasheet (External Link)
Vendor Page Anti CLPX pAb (ATL-HPA048199)