Anti CLPX pAb (ATL-HPA048199)

Atlas Antibodies

Catalog No.: ATL-HPA048199-25

Protein Description: caseinolytic mitochondrial matrix peptidase chaperone subunit
Gene Name: CLPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015357: 99%, ENSRNOG00000030225: 100%
Entrez Gene ID: 10845
Uniprot ID: O76031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPS
• Gene Sequence: GIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPS
• Gene ID - Mouse: ENSMUSG00000015357
• Gene ID - Rat: ENSRNOG00000030225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.