Anti CLPX pAb (ATL-HPA040262)

Atlas Antibodies

Catalog No.:
ATL-HPA040262-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: caseinolytic mitochondrial matrix peptidase chaperone subunit
Gene Name: CLPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015357: 87%, ENSRNOG00000030225: 90%
Entrez Gene ID: 10845
Uniprot ID: O76031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRLGTFETQILQRAPLRSFTETPAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHH
Gene Sequence GRLGTFETQILQRAPLRSFTETPAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHH
Gene ID - Mouse ENSMUSG00000015357
Gene ID - Rat ENSRNOG00000030225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLPX pAb (ATL-HPA040262)
Datasheet Anti CLPX pAb (ATL-HPA040262) Datasheet (External Link)
Vendor Page Anti CLPX pAb (ATL-HPA040262) at Atlas Antibodies

Documents & Links for Anti CLPX pAb (ATL-HPA040262)
Datasheet Anti CLPX pAb (ATL-HPA040262) Datasheet (External Link)
Vendor Page Anti CLPX pAb (ATL-HPA040262)
Citations for Anti CLPX pAb (ATL-HPA040262) – 6 Found
Becker, Christina; Kukat, Alexandra; Szczepanowska, Karolina; Hermans, Steffen; Senft, Katharina; Brandscheid, Christoph Paul; Maiti, Priyanka; Trifunovic, Aleksandra. CLPP deficiency protects against metabolic syndrome but hinders adaptive thermogenesis. Embo Reports. 2018;19(5)  PubMed
Borsuk, Robyn; Zhou, Lanlan; Chang, Wen-I; Zhang, Yiqun; Sharma, Aditi; Prabhu, Varun V; Tapinos, Nikos; Lulla, Rishi R; El-Deiry, Wafik S. Potent preclinical sensitivity to imipridone-based combination therapies in oncohistone H3K27M-mutant diffuse intrinsic pontine glioma is associated with induction of the integrated stress response, TRAIL death receptor DR5, reduced ClpX and apoptosis. American Journal Of Cancer Research. 11(9):4607-4623.  PubMed
Key, Jana; Torres-Odio, Sylvia; Bach, Nina C; Gispert, Suzana; Koepf, Gabriele; Reichlmeir, Marina; West, A Phillip; Prokisch, Holger; Freisinger, Peter; Newman, William G; Shalev, Stavit; Sieber, Stephan A; Wittig, Ilka; Auburger, Georg. Inactivity of Peptidase ClpP Causes Primary Accumulation of Mitochondrial Disaggregase ClpX with Its Interacting Nucleoid Proteins, and of mtDNA. Cells. 2021;10(12)  PubMed
Gispert, Suzana; Parganlija, Dajana; Klinkenberg, Michael; Dröse, Stefan; Wittig, Ilka; Mittelbronn, Michel; Grzmil, Pawel; Koob, Sebastian; Hamann, Andrea; Walter, Michael; Büchel, Finja; Adler, Thure; Hrabé de Angelis, Martin; Busch, Dirk H; Zell, Andreas; Reichert, Andreas S; Brandt, Ulrich; Osiewacz, Heinz D; Jendrach, Marina; Auburger, Georg. Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA and inflammatory factors. Human Molecular Genetics. 2013;22(24):4871-87.  PubMed
Siira, Stefan J; Rossetti, Giulia; Richman, Tara R; Perks, Kara; Ermer, Judith A; Kuznetsova, Irina; Hughes, Laetitia; Shearwood, Anne-Marie J; Viola, Helena M; Hool, Livia C; Rackham, Oliver; Filipovska, Aleksandra. Concerted regulation of mitochondrial and nuclear non-coding RNAs by a dual-targeted RNase Z. Embo Reports. 2018;19(10)  PubMed
Szczepanowska, Karolina; Senft, Katharina; Heidler, Juliana; Herholz, Marija; Kukat, Alexandra; Höhne, Michaela Nicole; Hofsetz, Eduard; Becker, Christina; Kaspar, Sophie; Giese, Heiko; Zwicker, Klaus; Guerrero-Castillo, Sergio; Baumann, Linda; Kauppila, Johanna; Rumyantseva, Anastasia; Müller, Stefan; Frese, Christian K; Brandt, Ulrich; Riemer, Jan; Wittig, Ilka; Trifunovic, Aleksandra. A salvage pathway maintains highly functional respiratory complex I. Nature Communications. 2020;11(1):1643.  PubMed