Anti CLPTM1 pAb (ATL-HPA068702)

Atlas Antibodies

Catalog No.:
ATL-HPA068702-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cleft lip and palate associated transmembrane protein 1
Gene Name: CLPTM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002981: 93%, ENSRNOG00000018255: 91%
Entrez Gene ID: 1209
Uniprot ID: O96005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY
Gene Sequence KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY
Gene ID - Mouse ENSMUSG00000002981
Gene ID - Rat ENSRNOG00000018255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLPTM1 pAb (ATL-HPA068702)
Datasheet Anti CLPTM1 pAb (ATL-HPA068702) Datasheet (External Link)
Vendor Page Anti CLPTM1 pAb (ATL-HPA068702) at Atlas Antibodies

Documents & Links for Anti CLPTM1 pAb (ATL-HPA068702)
Datasheet Anti CLPTM1 pAb (ATL-HPA068702) Datasheet (External Link)
Vendor Page Anti CLPTM1 pAb (ATL-HPA068702)