Anti CLPTM1 pAb (ATL-HPA068702)

Atlas Antibodies

Catalog No.: ATL-HPA068702-25

Protein Description: cleft lip and palate associated transmembrane protein 1
Gene Name: CLPTM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002981: 93%, ENSRNOG00000018255: 91%
Entrez Gene ID: 1209
Uniprot ID: O96005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY
• Gene Sequence: KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY
• Gene ID - Mouse: ENSMUSG00000002981
• Gene ID - Rat: ENSRNOG00000018255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.