Anti CLPS pAb (ATL-HPA010512 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA010512-25
  • Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CLPS antibody. Corresponding CLPS RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CLPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419722).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: colipase, pancreatic
Gene Name: CLPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024225: 73%, ENSRNOG00000000510: 72%
Entrez Gene ID: 1208
Uniprot ID: P04118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGR
Gene Sequence NLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGR
Gene ID - Mouse ENSMUSG00000024225
Gene ID - Rat ENSRNOG00000000510
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLPS pAb (ATL-HPA010512 w/enhanced validation)
Datasheet Anti CLPS pAb (ATL-HPA010512 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLPS pAb (ATL-HPA010512 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CLPS pAb (ATL-HPA010512 w/enhanced validation)
Datasheet Anti CLPS pAb (ATL-HPA010512 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CLPS pAb (ATL-HPA010512 w/enhanced validation)