Anti CLPP pAb (ATL-HPA010649 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010649-25

• 
• 
• 

Protein Description: caseinolytic mitochondrial matrix peptidase proteolytic subunit
Gene Name: CLPP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002660: 91%, ENSRNOG00000047052: 92%
Entrez Gene ID: 8192
Uniprot ID: Q16740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPA
• Gene Sequence: MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPA
• Gene ID - Mouse: ENSMUSG00000002660
• Gene ID - Rat: ENSRNOG00000047052
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CLPP pAb (ATL-HPA010649 w/enhanced validation) – 5 Found

Vincent, Amy E; Rosa, Hannah S; Pabis, Kamil; Lawless, Conor; Chen, Chun; Grünewald, Anne; Rygiel, Karolina A; Rocha, Mariana C; Reeve, Amy K; Falkous, Gavin; Perissi, Valentina; White, Kathryn; Davey, Tracey; Petrof, Basil J; Sayer, Avan A; Cooper, Cyrus; Deehan, David; Taylor, Robert W; Turnbull, Doug M; Picard, Martin. Subcellular origin of mitochondrial DNA deletions in human skeletal muscle. Annals Of Neurology. 2018;84(2):289-301. 

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Jenkinson, Emma M; Rehman, Atteeq U; Walsh, Tom; Clayton-Smith, Jill; Lee, Kwanghyuk; Morell, Robert J; Drummond, Meghan C; Khan, Shaheen N; Naeem, Muhammad Asif; Rauf, Bushra; Billington, Neil; Schultz, Julie M; Urquhart, Jill E; Lee, Ming K; Berry, Andrew; Hanley, Neil A; Mehta, Sarju; Cilliers, Deirdre; Clayton, Peter E; Kingston, Helen; Smith, Miriam J; Warner, Thomas T; Black, Graeme C; Trump, Dorothy; Davis, Julian R E; Ahmad, Wasim; Leal, Suzanne M; Riazuddin, Sheikh; King, Mary-Claire; Friedman, Thomas B; Newman, William G. Perrault syndrome is caused by recessive mutations in CLPP, encoding a mitochondrial ATP-dependent chambered protease. American Journal Of Human Genetics. 2013;92(4):605-13. 

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. 

Deshwal, Soni; Onishi, Mashun; Tatsuta, Takashi; Bartsch, Tim; Cors, Eileen; Ried, Katharina; Lemke, Kathrin; Nolte, Hendrik; Giavalisco, Patrick; Langer, Thomas. Mitochondria regulate intracellular coenzyme Q transport and ferroptotic resistance via STARD7. Nature Cell Biology. 2023;25(2):246-257.