Anti CLOCK pAb (ATL-HPA001867)

Atlas Antibodies

SKU: ATL-HPA001867-100

• 
• 
• 

Protein Description: clock circadian regulator
Gene Name: CLOCK
Alternative Gene Name: bHLHe8, KAT13D, KIAA0334
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029238: 90%, ENSRNOG00000002175: 90%
Entrez Gene ID: 9575
Uniprot ID: O15516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS
• Gene Sequence: RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS
• Gene ID - Mouse: ENSMUSG00000029238
• Gene ID - Rat: ENSRNOG00000002175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.