Anti CLOCK pAb (ATL-HPA001867)
Atlas Antibodies
- SKU:
- ATL-HPA001867-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: CLOCK
Alternative Gene Name: bHLHe8, KAT13D, KIAA0334
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029238: 90%, ENSRNOG00000002175: 90%
Entrez Gene ID: 9575
Uniprot ID: O15516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS |
Gene Sequence | RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS |
Gene ID - Mouse | ENSMUSG00000029238 |
Gene ID - Rat | ENSRNOG00000002175 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CLOCK pAb (ATL-HPA001867) | |
Datasheet | Anti CLOCK pAb (ATL-HPA001867) Datasheet (External Link) |
Vendor Page | Anti CLOCK pAb (ATL-HPA001867) at Atlas Antibodies |
Documents & Links for Anti CLOCK pAb (ATL-HPA001867) | |
Datasheet | Anti CLOCK pAb (ATL-HPA001867) Datasheet (External Link) |
Vendor Page | Anti CLOCK pAb (ATL-HPA001867) |