Anti CLNS1A pAb (ATL-HPA032045)

Atlas Antibodies

SKU:
ATL-HPA032045-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chloride channel, nucleotide-sensitive, 1A
Gene Name: CLNS1A
Alternative Gene Name: CLCI, ICln
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025439: 84%, ENSRNOG00000012788: 84%
Entrez Gene ID: 1207
Uniprot ID: P54105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEE
Gene Sequence SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEE
Gene ID - Mouse ENSMUSG00000025439
Gene ID - Rat ENSRNOG00000012788
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CLNS1A pAb (ATL-HPA032045)
Datasheet Anti CLNS1A pAb (ATL-HPA032045) Datasheet (External Link)
Vendor Page Anti CLNS1A pAb (ATL-HPA032045) at Atlas Antibodies

Documents & Links for Anti CLNS1A pAb (ATL-HPA032045)
Datasheet Anti CLNS1A pAb (ATL-HPA032045) Datasheet (External Link)
Vendor Page Anti CLNS1A pAb (ATL-HPA032045)