Anti CLNS1A pAb (ATL-HPA031708)

Atlas Antibodies

Catalog No.: ATL-HPA031708-25

Protein Description: chloride channel, nucleotide-sensitive, 1A
Gene Name: CLNS1A
Alternative Gene Name: CLCI, ICln
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025439: 94%, ENSRNOG00000012788: 95%
Entrez Gene ID: 1207
Uniprot ID: P54105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ
• Gene Sequence: EDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ
• Gene ID - Mouse: ENSMUSG00000025439
• Gene ID - Rat: ENSRNOG00000012788
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.