Anti CLNS1A pAb (ATL-HPA031708)

Atlas Antibodies

Catalog No.:
ATL-HPA031708-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chloride channel, nucleotide-sensitive, 1A
Gene Name: CLNS1A
Alternative Gene Name: CLCI, ICln
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025439: 94%, ENSRNOG00000012788: 95%
Entrez Gene ID: 1207
Uniprot ID: P54105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ
Gene Sequence EDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ
Gene ID - Mouse ENSMUSG00000025439
Gene ID - Rat ENSRNOG00000012788
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CLNS1A pAb (ATL-HPA031708)
Datasheet Anti CLNS1A pAb (ATL-HPA031708) Datasheet (External Link)
Vendor Page Anti CLNS1A pAb (ATL-HPA031708) at Atlas Antibodies

Documents & Links for Anti CLNS1A pAb (ATL-HPA031708)
Datasheet Anti CLNS1A pAb (ATL-HPA031708) Datasheet (External Link)
Vendor Page Anti CLNS1A pAb (ATL-HPA031708)